PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0172009.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family WOX
Protein Properties Length: 146aa    MW: 16918.9 Da    PI: 9.4545
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0172009.2genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox70.42.1e-2285144357
                      --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
         Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                      +R+++t+eql++Le+l+   +r+psae++e+++++l    +++ ++V++WFqN++a+e++
  Lj0g3v0172009.2  85 SRWNPTPEQLRALEDLYSGgTRTPSAEQIEHITAQLrrfgKIEGKNVFYWFQNHKARERQ 144
                      7*****************99**************************************97 PP

2Wus_type_Homeobox114.84.1e-3784146365
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ++RW+PtpeQ++ Le+ly+ G+rtP++e+i++ita+L+++Gkie+kNVfyWFQN+kaRerqk+
    Lj0g3v0172009.2  84 SSRWNPTPEQLRALEDLYSGGTRTPSAEQIEHITAQLRRFGKIEGKNVFYWFQNHKARERQKR 146
                        79***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.67E-1285144IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-985144IPR009057Homeodomain-like
PfamPF000464.2E-2085144IPR001356Homeobox domain
CDDcd000861.24E-686146No hitNo description
PROSITE profilePS5007110.68990145IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MWMVGYNEGG EFNMADHSFS GKKTRPFMPM PMASPNNALT TTTSIHGNTF FSQYHHYHHH  60
HQAILGEQQS KRDECNDGTP VVVSSRWNPT PEQLRALEDL YSGGTRTPSA EQIEHITAQL  120
RRFGKIEGKN VFYWFQNHKA RERQKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014508867.11e-66PREDICTED: WUSCHEL-related homeobox 1-like isoform X1
SwissprotQ6X7K02e-43WOX1_ARATH; WUSCHEL-related homeobox 1
TrEMBLA0A151TK733e-65A0A151TK73_CAJCA; WUSCHEL-related homeobox 1
TrEMBLG0ZGT33e-65G0ZGT3_MEDTR; STENOFOLIA
STRINGGLYMA05G33850.29e-64(Glycine max)
STRINGGLYMA08G05831.15e-64(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.19e-45WUSCHEL related homeobox 1